Structure of PDB 7mt3 Chain 2

Receptor sequence
>7mt32 (length=44) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence]
TKGKRTFQPNNRRRARVHGFRLRMRTRAGRSIVSSRRRKGRRTL
3D structure
PDB7mt3 Interplay between an ATP-binding cassette F protein and the ribosome from Mycobacterium tuberculosis.
Chain2
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 2 T2 K3 G4 R6 T7 F8 Q9 N11 N12 R13 R14 R15 A16 R17 H19 F21 R22 R24 R28 A29 I33 R37 R38 R39 K40 G41 R42 R43 T1 K2 G3 R5 T6 F7 Q8 N10 N11 R12 R13 R14 A15 R16 H18 F20 R21 R23 R27 A28 I32 R36 R37 R38 K39 G40 R41 R42
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7mt3, PDBe:7mt3, PDBj:7mt3
PDBsum7mt3
PubMed35064151
UniProtP9WH93|RL34_MYCTU Large ribosomal subunit protein bL34 (Gene Name=rpmH)

[Back to BioLiP]