Structure of PDB 7f9o Chain 2

Receptor sequence

>7f9o2 (length=203) Species: 77009 (Hordeum vulgare subsp. spontaneum) [Search protein sequence]

PERPIWFPGSTPPPWLDGSLPGDFGFDPWGLGSDPESLRWNVQAELVHCR
WAMLGAAGIFIPELLTKIGILNTPSWYTAGEQEYFTDTTTLFIVELILIG
WAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGYGTGSP
EKLKELRTKEIKNGRLAMLAVMGAWFQAEYTGTGPIDNLFAHLADPGHAT
IFR

3D structure

PDB

7f9o Architecture of the chloroplast PSI-NDH supercomplex in Hordeum vulgare.

Chain

Resolution

4.5 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CLA	2	R111 L115 F201 D202 L217 E221	R50 L54 F140 D141 L156 E160
BS02	CLA	2	K220 N224	K159 N163
BS03	CLA	2	G234 F237 Q238 T242 N249 H253 T261 I262	G173 F176 Q177 T181 N188 H192 T200 I201
BS04	CLA	2	G83 D84 F85 F87 N102 A105 E106 R226	G22 D23 F24 F26 N41 A44 E45 R165
BS05	CLA	2	N102 H109	N41 H48
BS06	CLA	2	K220 K223	K159 K162
BS07	CLA	2	H253 P257 T261 F263	H192 P196 T200 F202
BS08	CHL	2	Y138 T139 G141 E156 W236	Y77 T78 G80 E95 W175
BS09	CHL	2	R111 W112 W162 A163 R166 R167 D170 G194 P196 F201	R50 W51 W101 A102 R105 R106 D109 G133 P135 F140
BS10	CLA	2	W101 Q104 A105 V108 H109 W112 L157 I160 G161 E164 R167 W168	W40 Q43 A44 V47 H48 W51 L96 I99 G100 E103 R106 W107
BS11	CHL	2	G141 F146 L152 E156	G80 F85 L91 E95
BS12	CHL	2	W162 R166 N178 T179 D180 P181 N186 L188 W200	W101 R105 N117 T118 D119 P120 N125 L127 W139
BS13	CHL	2	W67 F68 P69 F85	W6 F7 P8 F24

Gene Ontology

	Molecular Function
GO:0016168	chlorophyll binding

	Biological Process
GO:0009416	response to light stimulus
GO:0009765	photosynthesis, light harvesting
GO:0009768	photosynthesis, light harvesting in photosystem I
GO:0015979	photosynthesis

	Cellular Component
GO:0009507	chloroplast
GO:0009522	photosystem I
GO:0009523	photosystem II
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7f9o, PDBe:7f9o, PDBj:7f9o
PDBsum	7f9o
PubMed	34879391
UniProt	Q43485

[Back to BioLiP]