Structure of PDB 7f0d Chain 2

Receptor sequence
>7f0d2 (length=42) Species: 419947 (Mycobacterium tuberculosis H37Ra) [Search protein sequence]
GKRTFQPNNRRRARVHGFRLRMRTRAGRSIVSSRRRKGRRTL
3D structure
PDB7f0d Cryo-EM structure of Mycobacterium tuberculosis 50S ribosomal subunit bound with clarithromycin reveals dynamic and specific interactions with macrolides.
Chain2
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 2 K5 R6 T7 F8 Q9 P10 N11 N12 R13 R14 R15 A16 R17 V18 H19 G20 F21 R22 R24 M25 R28 A29 R31 I33 S36 R37 R38 R39 K40 G41 R42 R43 K2 R3 T4 F5 Q6 P7 N8 N9 R10 R11 R12 A13 R14 V15 H16 G17 F18 R19 R21 M22 R25 A26 R28 I30 S33 R34 R35 R36 K37 G38 R39 R40
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7f0d, PDBe:7f0d, PDBj:7f0d
PDBsum7f0d
PubMed34935599
UniProtA5U9Q2|RL34_MYCTA Large ribosomal subunit protein bL34 (Gene Name=rpmH)

[Back to BioLiP]