Structure of PDB 6wu9 Chain 2

Receptor sequence
>6wu92 (length=56) Species: 474186 (Enterococcus faecalis OG1RF) [Search protein sequence]
AVPARRTSKAKKAKRRTHYKLTIKGLNACSNCGEMKKSHHVCPACGHYDG
KDVMSK
3D structure
PDB6wu9 Cryo-electron microscopy structure of the 70S ribosome from Enterococcus faecalis.
Chain2
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 2 A2 V3 P4 A5 R6 R7 T8 S9 K10 A11 K13 K15 R16 R17 T18 H19 K25 N28 S39 H40 Y49 D50 A1 V2 P3 A4 R5 R6 T7 S8 K9 A10 K12 K14 R15 R16 T17 H18 K24 N27 S38 H39 Y48 D49
BS02 ZN 2 C30 C33 C43 C29 C32 C42
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6wu9, PDBe:6wu9, PDBj:6wu9
PDBsum6wu9
PubMed33004869
UniProtQ836R0|RL323_ENTFA Large ribosomal subunit protein bL32C (Gene Name=rpmF3)

[Back to BioLiP]