Structure of PDB 6sko Chain 2

Receptor sequence
>6sko2 (length=346) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
FSWTEEEEREFRKISRDRGIIDKIISSMAPSIYGHRDIKTAVACSLFGGV
PKNVSIRGDINVLLLGDPGTAKSQILKYVEKTAHRAVFATGQGASAVGLT
ASVRKDEWTLEGGALVLADKGVCLIDEFDQDRTSIHEAMEQQSISISKAG
IVTTLQARCSIIAAANPNGGRYNSTLPLAQNVSLTEPILSRFDILCVVRD
LVDEEADERLATFVVDSHVRSHPENLQRQRKKEEEISPIPQELLMKYIHY
ARTKIYPKLHQMDMDKVSRVYADLRRESISTPITVRHLESILRIAESFAK
MRLSEFVSSYDLDRAIKVVVDSFVDAQKVSVRRQLRRSFAIYTLGH
3D structure
PDB6sko Cryo-EM Structure of the Fork Protection Complex Bound to CMG at a Replication Fork.
Chain2
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.6.4.12: DNA helicase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna 2 S572 V574 S579 W589 K633 A634 S95 V97 S102 W108 K148 A149
BS02 ANP 2 I505 Y506 P545 G546 T547 A548 K549 S550 Q551 I32 Y33 P68 G69 T70 A71 K72 S73 Q74
BS03 MG 2 K549 S550 K72 S73
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003682 chromatin binding
GO:0003688 DNA replication origin binding
GO:0003697 single-stranded DNA binding
GO:0004386 helicase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0008270 zinc ion binding
GO:0016787 hydrolase activity
GO:0016887 ATP hydrolysis activity
GO:0017116 single-stranded DNA helicase activity
GO:0043138 3'-5' DNA helicase activity
GO:0046872 metal ion binding
Biological Process
GO:0000727 double-strand break repair via break-induced replication
GO:0006260 DNA replication
GO:0006267 pre-replicative complex assembly involved in nuclear cell cycle DNA replication
GO:0006268 DNA unwinding involved in DNA replication
GO:0006270 DNA replication initiation
GO:0006271 DNA strand elongation involved in DNA replication
GO:0006279 premeiotic DNA replication
GO:0006974 DNA damage response
GO:0032508 DNA duplex unwinding
GO:1902975 mitotic DNA replication initiation
GO:1905775 negative regulation of DNA helicase activity
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005656 nuclear pre-replicative complex
GO:0005737 cytoplasm
GO:0031261 DNA replication preinitiation complex
GO:0031298 replication fork protection complex
GO:0042555 MCM complex
GO:0043596 nuclear replication fork
GO:0071162 CMG complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6sko, PDBe:6sko, PDBj:6sko
PDBsum6sko
PubMed32369734
UniProtP29469|MCM2_YEAST DNA replication licensing factor MCM2 (Gene Name=MCM2)

[Back to BioLiP]