Structure of PDB 6s12 Chain 2

Receptor sequence
>6s122 (length=43) Species: 1280 (Staphylococcus aureus) [Search protein sequence]
VKRTYQPNKRKHSKVHGFRKRMSTKNGRKVLARRRRKGRKVLS
3D structure
PDB6s12 Exit tunnel modulation as resistance mechanism of S. aureus erythromycin resistant mutant.
Chain2
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 2 V2 K3 R4 Y6 Q7 N9 K10 R11 K12 H13 S14 K15 H17 G18 F19 R20 R22 M23 K26 N27 K30 V31 R34 R36 R37 K38 R40 K41 V1 K2 R3 Y5 Q6 N8 K9 R10 K11 H12 S13 K14 H16 G17 F18 R19 R21 M22 K25 N26 K29 V30 R33 R35 R36 K37 R39 K40
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6s12, PDBe:6s12, PDBj:6s12
PDBsum6s12
PubMed31391518
UniProtW8TQ59

[Back to BioLiP]