Structure of PDB 6o8x Chain 2

Receptor sequence
>6o8x2 (length=56) Species: 1351 (Enterococcus faecalis) [Search protein sequence]
AVPARRTSKAKKAKRRTHYKLTIKGLNACSNCGEMKKSHHVCPACGHYDG
KDVMSK
3D structure
PDB6o8x Cryo-electron microscopy structure of the 70S ribosome from Enterococcus faecalis.
Chain2
Resolution3.68 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 2 A2 V3 P4 A5 R6 R7 T8 S9 K10 K13 A14 K15 R16 R17 T18 H19 K21 K25 N28 H40 Y49 D50 A1 V2 P3 A4 R5 R6 T7 S8 K9 K12 A13 K14 R15 R16 T17 H18 K20 K24 N27 H39 Y48 D49
BS02 ZN 2 C30 K37 C43 C46 C29 K36 C42 C45
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6o8x, PDBe:6o8x, PDBj:6o8x
PDBsum6o8x
PubMed33004869
UniProtA0A1B4XMM2

[Back to BioLiP]