Structure of PDB 6ijo Chain 2

Receptor sequence

>6ijo2 (length=173) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]

RPMWYPGATAPAHLDGSMLGDYGFDPLRLGVNKDNLKWFREAELTNGRWA
MAAVVGILFTDAVGLPKFWTAGAEKYALDNQTLALIEVAVFAVLEGKRYE
IYKKTGETGFLSFAPFDPMGMKSEEMKLKELKNGRLAMLAFLGFCSQAAV
YGKGPIETLQLHLADPGHNNIYT

3D structure

PDB

6ijo Antenna arrangement and energy transfer pathways of a green algal photosystem-I-LHCI supercomplex.

Chain

Resolution

3.3 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	2	Y13 Y180 T181	Y5 Y172 T173
BS02	CLA	2	M11 W12 Y13 P14	M3 W4 Y5 P6
BS03	CLA	2	Y30 F32 E51 R143 M146	Y22 F24 E43 R135 M138
BS04	CLA	2	G64 L73	G56 L65
BS05	CLA	2	E95 F99	E87 F91
BS06	CLA	2	W77 G80 A81	W69 G72 A73
BS07	CLA	2	T53 W57 E103 Y110	T45 W49 E95 Y102
BS08	CLA	2	R56 M59 G117 M129 E138	R48 M51 G109 M121 E130
BS09	CLA	2	K137 N141	K129 N133
BS10	CLA	2	G151 S154 Q155 Y159 I179	G143 S146 Q147 Y151 I171
BS11	CLA	2	L167 H170 L171	L159 H162 L163

Gene Ontology

	Molecular Function
GO:0016168	chlorophyll binding

	Biological Process
GO:0009416	response to light stimulus
GO:0009765	photosynthesis, light harvesting
GO:0009768	photosynthesis, light harvesting in photosystem I
GO:0015979	photosynthesis

	Cellular Component
GO:0009507	chloroplast
GO:0009522	photosystem I
GO:0009523	photosystem II
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6ijo, PDBe:6ijo, PDBj:6ijo
PDBsum	6ijo
PubMed	30850819
UniProt	A8IKC8

[Back to BioLiP]