Structure of PDB 5v7q Chain 2

Receptor sequence
>5v7q2 (length=42) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence]
GKRTFQPNNRRRARVHGFRLRMRTRAGRSIVSSRRRKGRRTL
3D structure
PDB5v7q Structural insights into species-specific features of the ribosome from the human pathogen Mycobacterium tuberculosis.
Chain2
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 2 G4 K5 R6 F8 Q9 N11 N12 R13 R14 R15 A16 R17 H19 F21 R22 R24 M25 R26 R28 A29 I33 R37 R38 K40 G41 R42 R43 L45 G1 K2 R3 F5 Q6 N8 N9 R10 R11 R12 A13 R14 H16 F18 R19 R21 M22 R23 R25 A26 I30 R34 R35 K37 G38 R39 R40 L42
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5v7q, PDBe:5v7q, PDBj:5v7q
PDBsum5v7q
PubMed28977617
UniProtP9WH93|RL34_MYCTU Large ribosomal subunit protein bL34 (Gene Name=rpmH)

[Back to BioLiP]