Structure of PDB 5oom Chain 2

Receptor sequence
>5oom2 (length=43) Species: 9606 (Homo sapiens) [Search protein sequence]
GNEYQPSNIKRKNKHGWVRRLSTPAGVQVILRRMLKGRKSLSH
3D structure
PDB5oom Structures of the human mitochondrial ribosome in native states of assembly.
Chain2
Resolution3.03 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 2 G50 N51 E52 Y53 Q54 P55 S56 N57 K59 K61 N62 K63 H64 G65 W66 V67 R69 A74 V78 R81 R82 K85 G86 R87 K88 H92 G1 N2 E3 Y4 Q5 P6 S7 N8 K10 K12 N13 K14 H15 G16 W17 V18 R20 A25 V29 R32 R33 K36 G37 R38 K39 H43
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005761 mitochondrial ribosome
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5oom, PDBe:5oom, PDBj:5oom
PDBsum5oom
PubMed28892042
UniProtQ9BQ48|RM34_HUMAN Large ribosomal subunit protein bL34m (Gene Name=MRPL34)

[Back to BioLiP]