Structure of PDB 5jvh Chain 2

Receptor sequence
>5jvh2 (length=46) Species: 243230 (Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539) [Search protein sequence]
MKRTYQPNNRKRAKTHGFRARMKTKSGRNILARRRAKGRHQLTVSD
3D structure
PDB5jvh Avilamycin and evernimicin induce structural changes in rProteins uL16 and CTC that enhance the inhibition of A-site tRNA binding.
Chain2
Resolution3.58 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 2 M1 K2 R3 T4 Y5 Q6 P7 N8 N9 R10 K11 R12 A13 K14 H16 G17 F18 R19 R21 M22 S26 I30 R33 R34 R35 K37 R39 H40 Q41 V44 M1 K2 R3 T4 Y5 Q6 P7 N8 N9 R10 K11 R12 A13 K14 H16 G17 F18 R19 R21 M22 S26 I30 R33 R34 R35 K37 R39 H40 Q41 V44
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5jvh, PDBe:5jvh, PDBj:5jvh
PDBsum5jvh
PubMed27791159
UniProtQ9RSH2|RL34_DEIRA Large ribosomal subunit protein bL34 (Gene Name=rpmH)

[Back to BioLiP]