Structure of PDB 4wce Chain 2

Receptor sequence
>4wce2 (length=44) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]
VKRTYQPNKRKHSKVHGFRKRMSTKNGRKVLARRRRKGRKVLSA
3D structure
PDB4wce Structural insights into species-specific features of the ribosome from the pathogen Staphylococcus aureus.
Chain2
Resolution3.526 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 2 V2 K3 R4 T5 Y6 Q7 P8 N9 K10 R11 K12 H13 K15 V16 H17 G18 F19 R20 R22 K26 N27 R29 R34 R35 R36 G39 R40 K41 V1 K2 R3 T4 Y5 Q6 P7 N8 K9 R10 K11 H12 K14 V15 H16 G17 F18 R19 R21 K25 N26 R28 R33 R34 R35 G38 R39 K40
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4wce, PDBe:4wce, PDBj:4wce
PDBsum4wce
PubMed26464510
UniProtQ2FUQ0|RL34_STAA8 Large ribosomal subunit protein bL34 (Gene Name=rpmH)

[Back to BioLiP]