Structure of PDB 4dx9 Chain 2 |
>4dx92 (length=91) Species: 9606 (Homo sapiens) [Search protein sequence] |
CAEFRIKYVGAIGPLDLINYIDVAQQIMGVSKYGIDVLHRHALYLIIRMV CYDKSLLALKTTSLWVYQCNSLEQAQAICKVLSTAFDSVLT |
|
PDB | 4dx9 Mechanism for KRIT1 Release of ICAP1-Mediated Suppression of Integrin Activation. |
Chain | 2 |
Resolution | 2.99 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
2 |
I138 I139 F191 |
I46 I47 F86 |
|
|
|