Structure of PDB 3cxc Chain 2

Receptor sequence

>3cxc2 (length=92) Species: 2238 (Haloarcula marismortui) [Search protein sequence]

MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDG
KFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE

3D structure

PDB

3cxc Design at the atomic level: design of biaryloxazolidinones as potent orally active antibiotics.

Chain

Resolution

3.0 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	2	M1 Q2 P4 N8 T9 Y10 H13 N15 E16 H17 V25 S27 G28 R29 Q30 T31 M33 K34 W35 I36 R38 Q39 R42 N43 G45 I46 G47 N48 G50 K51 S53 K54 G58 D59 K60 P61 T62 K63 K64 D66 K68 K76 A77 L79 R80 G82 R84 A85 G86 Q91	M1 Q2 P4 N8 T9 Y10 H13 N15 E16 H17 V25 S27 G28 R29 Q30 T31 M33 K34 W35 I36 R38 Q39 R42 N43 G45 I46 G47 N48 G50 K51 S53 K54 G58 D59 K60 P61 T62 K63 K64 D66 K68 K76 A77 L79 R80 G82 R84 A85 G86 Q91	PDBbind-CN: IC50=4.6uM
BS02	MG	2	G45 G47 D49	G45 G47 D49

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003735	structural constituent of ribosome
GO:0008270	zinc ion binding
GO:0019843	rRNA binding
GO:0046872	metal ion binding
GO:0070180	large ribosomal subunit rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:3cxc, PDBe:3cxc, PDBj:3cxc
PDBsum	3cxc
PubMed	18947996
UniProt	P32411\|RL44E_HALMA Large ribosomal subunit protein eL42 (Gene Name=rpl44e)