Structure of PDB 2zjr Chain 2

Receptor sequence
>2zjr2 (length=46) Species: 1299 (Deinococcus radiodurans) [Search protein sequence]
MKRTYQPNNRKRAKTHGFRARMKTKSGRNILARRRAKGRHQLTVSD
3D structure
PDB2zjr Translational regulation via L11: molecular switches on the ribosome turned on and off by thiostrepton and micrococcin.
Chain2
Resolution2.91 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 2 M1 R12 M1 R12
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2zjr, PDBe:2zjr, PDBj:2zjr
PDBsum2zjr
PubMed18406324
UniProtQ9RSH2|RL34_DEIRA Large ribosomal subunit protein bL34 (Gene Name=rpmH)

[Back to BioLiP]