Structure of PDB 1nji Chain 2

Receptor sequence

>1nji2 (length=56) Species: 2238 (Haloarcula marismortui)

TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEW
QSKAGE

3D structure

• PDB: 1nji Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
• Chain: 2
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	2	T1 G2 A3 G4 T5 P6 S7 Q8 G9 K10 K11 N12 T13 T14 T15 H16 T17 K18 C19 R20 R21 C22 G23 K25 S26 Y27 H28 T29 K30 K31 K32 S35 F39 K41 S42 K44 R45 R46 Y48 E49 W50 K53 A54	T1 G2 A3 G4 T5 P6 S7 Q8 G9 K10 K11 N12 T13 T14 T15 H16 T17 K18 C19 R20 R21 C22 G23 K25 S26 Y27 H28 T29 K30 K31 K32 S35 F39 K41 S42 K44 R45 R46 Y48 E49 W50 K53 A54

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0008270 zinc ion binding
• GO:0019843 rRNA binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:1nji, PDBe:1nji, PDBj:1nji
• PDBsum: 1nji
• PubMed: 12860128
• UniProt: P32410|RL37_HALMA Large ribosomal subunit protein eL37 (Gene Name=rpl37e)