Structure of PDB 1etb Chain 2

Receptor sequence

>1etb2 (length=117) Species: 9606 (Homo sapiens)

KCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGL
TTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIA
TLLSPYSYSTTAVVTNP

3D structure

• PDB: 1etb The x-ray crystal structure refinements of normal human transthyretin and the amyloidogenic Val-30-->Met variant to 1.7-A resolution.
• Chain: 2
• Resolution: 1.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	T44	2	K15 L17 E54 A108 T109 L110	K7 L9 E46 A100 T101 L102	BindingDB: IC50=10500nM

Gene Ontology

Molecular Function

• GO:0005179 hormone activity
• GO:0005515 protein binding
• GO:0042802 identical protein binding
• GO:0070324 thyroid hormone binding

Biological Process

• GO:0006144 purine nucleobase metabolic process
• GO:0007165 signal transduction

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space
• GO:0005737 cytoplasm
• GO:0035578 azurophil granule lumen
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:1etb, PDBe:1etb, PDBj:1etb
• PDBsum: 1etb
• PubMed: 8428915
• UniProt: P02766|TTHY_HUMAN Transthyretin (Gene Name=TTR)