Structure of PDB 1c4y Chain 2

Receptor sequence

>1c4y2 (length=254) Species: 9606 (Homo sapiens)

IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI
ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETWTA
GQPSVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGD
SGGPFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVI
DQFG

3D structure

• PDB: 1c4y Structure of thrombin complexed with selective non-electrophilic inhibitors having cyclohexyl moieties at P1.
• Chain: 2
• Resolution: 2.7 Å

Enzymatic activity

• Enzyme Commision number: 3.4.21.5: thrombin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	2	E23 G25 M26 P28 W29 D116 H119 P120 C122 L129C Y134 K135 R137 N159 M201 K202 P204 R206 W207	E8 G10 M11 P13 W14 D113 H116 P117 C119 L129 Y134 K135 R137 N160 M207 K208 P210 R214 W215
BS02	peptide	2	F34 R67 R73 T74 R75 Y76 I82 M84	F19 R62 R68 T69 R70 Y71 I78 M80
BS03	IH3	2	H57 Y60A W60D L99 R173 I174 D189 A190 V213 W215 G216 E217	H43 Y47 W50 L96 R174 I175 D195 A196 V221 W223 G224 E225	PDBbind-CN: -logKd/Ki=7.92,Ki=12nM

Gene Ontology

Molecular Function

• GO:0004252 serine-type endopeptidase activity
• GO:0005509 calcium ion binding

Biological Process

• GO:0006508 proteolysis
• GO:0007596 blood coagulation

External links

• PDB: RCSB:1c4y, PDBe:1c4y, PDBj:1c4y
• PDBsum: 1c4y
• PubMed: 10713516
• UniProt: P00734|THRB_HUMAN Prothrombin (Gene Name=F2)