Structure of PDB 8vty Chain 1y

Receptor sequence
>8vty1y (length=97) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
TMNITSKQMEITPAIRQHVADRLAKLEKWQTHLINPHIILSKEPQGFVAD
ATINTPNGVLVASGKHEDMYTAINELINKLERQLNKLQHKGEARRAA
3D structure
PDB8vty Macrolones target bacterial ribosomes and DNA gyrase and can evade resistance mechanisms.
Chain1y
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 1y T2 N4 I5 T6 K8 R17 R23 K29 W30 H33 P45 Q46 T53 N55 P57 V62 A63 S64 T72 K80 R83 Q84 K87 H90 K91 A94 R95 R96 T1 N3 I4 T5 K7 R16 R22 K28 W29 H32 P44 Q45 T52 N54 P56 V61 A62 S63 T71 K79 R82 Q83 K86 H89 K90 A93 R94 R95
BS02 MG 1y E11 I12 E10 I11
BS03 MG 1y I5 R17 I4 R16
External links
PDB RCSB:8vty, PDBe:8vty, PDBj:8vty
PDBsum8vty
PubMed39039256
UniProtP0AD49|YFIA_ECOLI Ribosome-associated inhibitor A (Gene Name=raiA)

[Back to BioLiP]