Structure of PDB 8fc6 Chain 1y

Receptor sequence
>8fc61y (length=97) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
TMNITSKQMEITPAIRQHVADRLAKLEKWQTHLINPHIILSKEPQGFVAD
ATINTPNGVLVASGKHEDMYTAINELINKLERQLNKLQHKGEARRAA
3D structure
PDB8fc6 Structural insights into the mechanism of overcoming Erm-mediated resistance by macrolides acting together with hygromycin-A.
Chain1y
Resolution2.35 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0019843 rRNA binding
GO:0043024 ribosomal small subunit binding
Biological Process
GO:0006417 regulation of translation
GO:0009409 response to cold
GO:0022611 dormancy process
GO:0044238 primary metabolic process
GO:0045900 negative regulation of translational elongation
GO:0045947 negative regulation of translational initiation
Cellular Component
GO:0005829 cytosol
GO:0022627 cytosolic small ribosomal subunit

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8fc6, PDBe:8fc6, PDBj:8fc6
PDBsum8fc6
PubMed37452045
UniProtP0AD49|YFIA_ECOLI Ribosome-associated inhibitor A (Gene Name=raiA)

[Back to BioLiP]