Structure of PDB 7rqe Chain 1y

Receptor sequence
>7rqe1y (length=97) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
TMNITSKQMEITPAIRQHVADRLAKLEKWQTHLINPHIILSKEPQGFVAD
ATINTPNGVLVASGKHEDMYTAINELINKLERQLNKLQHKGEARRAA
3D structure
PDB7rqe Structural basis for the context-specific action of the classic peptidyl transferase inhibitor chloramphenicol.
Chain1y
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 1y T2 N4 I5 T6 K8 Q9 R17 R23 K26 K29 W30 Q31 H33 P45 Q46 T53 P57 V62 A63 S64 K80 R83 Q84 K87 H90 K91 E93 A94 R95 R96 T1 N3 I4 T5 K7 Q8 R16 R22 K25 K28 W29 Q30 H32 P44 Q45 T52 P56 V61 A62 S63 K79 R82 Q83 K86 H89 K90 E92 A93 R94 R95
BS02 MG 1y N4 I5 N3 I4
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0019843 rRNA binding
GO:0043024 ribosomal small subunit binding
Biological Process
GO:0006417 regulation of translation
GO:0009409 response to cold
GO:0022611 dormancy process
GO:0044238 primary metabolic process
GO:0045900 negative regulation of translational elongation
GO:0045947 negative regulation of translational initiation
Cellular Component
GO:0005829 cytosol
GO:0022627 cytosolic small ribosomal subunit

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7rqe, PDBe:7rqe, PDBj:7rqe
PDBsum7rqe
PubMed35165455
UniProtP0AD49|YFIA_ECOLI Ribosome-associated inhibitor A (Gene Name=raiA)

[Back to BioLiP]