Structure of PDB 7rqb Chain 1y

Receptor sequence

>7rqb1y (length=97) Species: 83333 (Escherichia coli K-12) [Search protein sequence]

TMNITSKQMEITPAIRQHVADRLAKLEKWQTHLINPHIILSKEPQGFVAD
ATINTPNGVLVASGKHEDMYTAINELINKLERQLNKLQHKGEARRAA

3D structure

PDB

7rqb Structural basis for the context-specific action of the classic peptidyl transferase inhibitor chloramphenicol.

Chain

Resolution

2.45 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	1y	T2 N4 I5 T6 K8 Q9 R17 K26 K29 W30 Q31 H33 I35 N36 H38 P45 Q46 T53 N55 P57 V62 A63 S64 K80 R83 Q84 K87 H90 K91 E93 A94 R96	T1 N3 I4 T5 K7 Q8 R16 K25 K28 W29 Q30 H32 I34 N35 H37 P44 Q45 T52 N54 P56 V61 A62 S63 K79 R82 Q83 K86 H89 K90 E92 A93 R95
BS02	MG	1y	N4 I5	N3 I4

Gene Ontology

	Molecular Function
GO:0005515	protein binding
GO:0019843	rRNA binding
GO:0043024	ribosomal small subunit binding

	Biological Process
GO:0006417	regulation of translation
GO:0009409	response to cold
GO:0022611	dormancy process
GO:0044238	primary metabolic process
GO:0045900	negative regulation of translational elongation
GO:0045947	negative regulation of translational initiation

	Cellular Component
GO:0005829	cytosol
GO:0022627	cytosolic small ribosomal subunit

External links

PDB	RCSB:7rqb, PDBe:7rqb, PDBj:7rqb
PDBsum	7rqb
PubMed	35165455
UniProt	P0AD49\|YFIA_ECOLI Ribosome-associated inhibitor A (Gene Name=raiA)