Structure of PDB 7rqa Chain 1y

Receptor sequence

>7rqa1y (length=97) Species: 83333 (Escherichia coli K-12) [Search protein sequence]

TMNITSKQMEITPAIRQHVADRLAKLEKWQTHLINPHIILSKEPQGFVAD
ATINTPNGVLVASGKHEDMYTAINELINKLERQLNKLQHKGEARRAA

3D structure

PDB

7rqa Structural basis for the context-specific action of the classic peptidyl transferase inhibitor chloramphenicol.

Chain

Resolution

2.4 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	1y	T2 N4 I5 T6 K8 Q9 R17 R23 K26 K29 W30 H33 N36 P45 Q46 T53 V62 A63 S64 T72 K80 R83 Q84 K87 H90 K91 A94 R95 R96	T1 N3 I4 T5 K7 Q8 R16 R22 K25 K28 W29 H32 N35 P44 Q45 T52 V61 A62 S63 T71 K79 R82 Q83 K86 H89 K90 A93 R94 R95
BS02	MG	1y	E11 I12 R17	E10 I11 R16
BS03	MG	1y	N4 I5	N3 I4

Gene Ontology

	Molecular Function
GO:0005515	protein binding
GO:0019843	rRNA binding
GO:0043024	ribosomal small subunit binding

	Biological Process
GO:0006417	regulation of translation
GO:0009409	response to cold
GO:0022611	dormancy process
GO:0044238	primary metabolic process
GO:0045900	negative regulation of translational elongation
GO:0045947	negative regulation of translational initiation

	Cellular Component
GO:0005829	cytosol
GO:0022627	cytosolic small ribosomal subunit

External links

PDB	RCSB:7rqa, PDBe:7rqa, PDBj:7rqa
PDBsum	7rqa
PubMed	35165455
UniProt	P0AD49\|YFIA_ECOLI Ribosome-associated inhibitor A (Gene Name=raiA)