Structure of PDB 6cfl Chain 1y

Receptor sequence

>6cfl1y (length=97) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

TMNITSKQMEITPAIRQHVADRLAKLEKWQTHLINPHIILSKEPQGFVAD
ATINTPNGVLVASGKHEDMYTAINELINKLERQLNKLQHKGEARRAA

3D structure

PDB

6cfl Binding and Action of Amino Acid Analogs of Chloramphenicol upon the Bacterial Ribosome.

Chain

Resolution

2.6 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	1y	N4 I5 T6 S7 K8 Q9 R17 R23 K26 K29 W30 H33 I35 P45 Q46 T53 N55 P57 V62 A63 S64 K80 R83 Q84 K87 H90 K91 E93 A94 R95 R96	N3 I4 T5 S6 K7 Q8 R16 R22 K25 K28 W29 H32 I34 P44 Q45 T52 N54 P56 V61 A62 S63 K79 R82 Q83 K86 H89 K90 E92 A93 R94 R95
BS02	MG	1y	E11 I12	E10 I11
BS03	MG	1y	N4 I5	N3 I4

Gene Ontology

	Molecular Function
GO:0005515	protein binding
GO:0019843	rRNA binding
GO:0043024	ribosomal small subunit binding

	Biological Process
GO:0006417	regulation of translation
GO:0009409	response to cold
GO:0022611	dormancy process
GO:0044238	primary metabolic process
GO:0045900	negative regulation of translational elongation
GO:0045947	negative regulation of translational initiation

	Cellular Component
GO:0005829	cytosol
GO:0022627	cytosolic small ribosomal subunit

External links

PDB	RCSB:6cfl, PDBe:6cfl, PDBj:6cfl
PDBsum	6cfl
PubMed	29410130
UniProt	P0AD49\|YFIA_ECOLI Ribosome-associated inhibitor A (Gene Name=raiA)