Structure of PDB 5v8i Chain 1y

Receptor sequence

>5v8i1y (length=97) Species: 83333 (Escherichia coli K-12) [Search protein sequence]

TMNITSKQMEITPAIRQHVADRLAKLEKWQTHLINPHIILSKEPQGFVAD
ATINTPNGVLVASGKHEDMYTAINELINKLERQLNKLQHKGEARRAA

3D structure

PDB

5v8i Structural robustness of the ribosome inferred from X-ray crystal structures of the 30S ribosomal subunit and the 70S ribosome lacking ribosomal protein uS17

Chain

Resolution

3.25 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	1y	N4 I5 T6 S7 K8 R17 R23 K26 K29 W30 H33 H38 P45 Q46 T53 N55 P57 V62 A63 S64 N75 K80 R83 Q84 K87 H90 K91 E93 A94 R95 R96	N3 I4 T5 S6 K7 R16 R22 K25 K28 W29 H32 H37 P44 Q45 T52 N54 P56 V61 A62 S63 N74 K79 R82 Q83 K86 H89 K90 E92 A93 R94 R95
BS02	MG	1y	E11 I12	E10 I11
BS03	MG	1y	N4 I5	N3 I4

Gene Ontology

	Molecular Function
GO:0005515	protein binding
GO:0019843	rRNA binding
GO:0043024	ribosomal small subunit binding

	Biological Process
GO:0006417	regulation of translation
GO:0009409	response to cold
GO:0022611	dormancy process
GO:0044238	primary metabolic process
GO:0045900	negative regulation of translational elongation
GO:0045947	negative regulation of translational initiation

	Cellular Component
GO:0005829	cytosol
GO:0022627	cytosolic small ribosomal subunit

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5v8i, PDBe:5v8i, PDBj:5v8i
PDBsum	5v8i
PubMed
UniProt	P0AD49\|YFIA_ECOLI Ribosome-associated inhibitor A (Gene Name=raiA)

[Back to BioLiP]