Structure of PDB 5fdu Chain 1x

Receptor sequence
>5fdu1x (length=97) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
TMNITSKQMEITPAIRQHVADRLAKLEKWQTHLINPHIILSKEPQGFVAD
ATINTPNGVLVASGKHEDMYTAINELINKLERQLNKLQHKGEARRAA
3D structure
PDB5fdu Structure of the mammalian antimicrobial peptide Bac7(1-16) bound within the exit tunnel of a bacterial ribosome.
Chain1x
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 1x T2 N4 I5 T6 K8 R17 R23 K26 K29 W30 H33 I35 P45 Q46 T53 N55 P57 V62 A63 S64 K80 R83 Q84 K87 H90 K91 E93 A94 R95 R96 T1 N3 I4 T5 K7 R16 R22 K25 K28 W29 H32 I34 P44 Q45 T52 N54 P56 V61 A62 S63 K79 R82 Q83 K86 H89 K90 E92 A93 R94 R95
Gene Ontology
Biological Process
GO:0044238 primary metabolic process

View graph for
Biological Process
External links
PDB RCSB:5fdu, PDBe:5fdu, PDBj:5fdu
PDBsum5fdu
PubMed26792896
UniProtP0AD49|YFIA_ECOLI Ribosome-associated inhibitor A (Gene Name=raiA)

[Back to BioLiP]