Structure of PDB 8vty Chain 1t

Receptor sequence

>8vty1t (length=96) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMR
KAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGG

3D structure

PDB

8vty Macrolones target bacterial ribosomes and DNA gyrase and can evade resistance mechanisms.

Chain

Resolution

2.6 Å

3D
structure

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	1t	L10 K14 R15 H16 R17 S19 R22 R23 N26 A28 K29 S31 A32 K34 T35 K39 L43 E51 K54 E60 S61 D64 K65 K68 S70 H73 K74 N75 A78 R79 K81 S82 R83 M85 R89 G101 G102 G103	L3 K7 R8 H9 R10 S12 R15 R16 N19 A21 K22 S24 A25 K27 T28 K32 L36 E44 K47 E53 S54 D57 K58 K61 S63 H66 K67 N68 A71 R72 K74 S75 R76 M78 R82 G94 G95 G96
BS02	MG	1t	A67 G69 L72	A60 G62 L65

External links

PDB	RCSB:8vty, PDBe:8vty, PDBj:8vty
PDBsum	8vty
PubMed	39039256
UniProt	P80380\|RS20_THET8 Small ribosomal subunit protein bS20 (Gene Name=rpsT)