Structure of PDB 8uvs Chain 1t

Receptor sequence

>8uvs1t (length=96) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMR
KAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGG

3D structure

PDB

8uvs Development of 2nd generation aminomethyl spectinomycins that overcome native efflux in Mycobacterium abscessus.

Chain

Resolution

2.75 Å

3D
structure

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	1t	L10 K14 R15 H16 R17 Q18 S19 R22 R23 N26 K29 S31 K34 T35 K39 E51 K54 I55 R57 E60 S61 D64 K68 S70 H73 K74 N75 A78 R79 K81 S82 R83 M85 R89 G101 G102 G103	L3 K7 R8 H9 R10 Q11 S12 R15 R16 N19 K22 S24 K27 T28 K32 E44 K47 I48 R50 E53 S54 D57 K61 S63 H66 K67 N68 A71 R72 K74 S75 R76 M78 R82 G94 G95 G96
BS02	MG	1t	A67 G69 L72	A60 G62 L65

External links

PDB	RCSB:8uvs, PDBe:8uvs, PDBj:8uvs
PDBsum	8uvs
PubMed	38165935
UniProt	P80380\|RS20_THET8 Small ribosomal subunit protein bS20 (Gene Name=rpsT)