Structure of PDB 8fc4 Chain 1t

Receptor sequence

>8fc41t (length=96) Species: 300852 (Thermus thermophilus HB8)

RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMR
KAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGG

3D structure

• PDB: 8fc4 Structural insights into the mechanism of overcoming Erm-mediated resistance by macrolides acting together with hygromycin-A.
• Chain: 1t
• Resolution: 2.45 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	1t	L10 S11 K14 R15 H16 R17 S19 R22 R23 N26 A28 K29 S31 A32 K34 T35 K39 L43 E51 K54 I55 R57 E60 S61 D64 K65 K68 S70 H73 K74 N75 A78 R79 K81 S82 R83 M85 G101 G102 G103	L3 S4 K7 R8 H9 R10 S12 R15 R16 N19 A21 K22 S24 A25 K27 T28 K32 L36 E44 K47 I48 R50 E53 S54 D57 K58 K61 S63 H66 K67 N68 A71 R72 K74 S75 R76 M78 G94 G95 G96
BS02	MG	1t	A67 G69 L72	A60 G62 L65

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding
• GO:0070181 small ribosomal subunit rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8fc4, PDBe:8fc4, PDBj:8fc4
• PDBsum: 8fc4
• PubMed: 37452045
• UniProt: P80380|RS20_THET8 Small ribosomal subunit protein bS20 (Gene Name=rpsT)