Structure of PDB 8vtw Chain 1q

Receptor sequence

>8vtw1q (length=99) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKY
KLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK

3D structure

PDB

8vtw Macrolones target bacterial ribosomes and DNA gyrase and can evade resistance mechanisms.

Chain

Resolution

2.35 Å

3D
structure

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	1q	P2 K3 S12 K14 M15 Q16 K17 T18 R25 L31 Y32 K34 R38 S39 K40 K41 Y42 E61 R63 P64 I65 S66 K67 R68 K69 R70 R72 K87 R91 R92 N94 Y95 S97 L98 S99 K100	P1 K2 S11 K13 M14 Q15 K16 T17 R24 L30 Y31 K33 R37 S38 K39 K40 Y41 E60 R62 P63 I64 S65 K66 R67 K68 R69 R71 K86 R90 R91 N93 Y94 S96 L97 S98 K99

External links

PDB	RCSB:8vtw, PDBe:8vtw, PDBj:8vtw
PDBsum	8vtw
PubMed	39039256
UniProt	P0DOY7\|RS17_THET8 Small ribosomal subunit protein uS17 (Gene Name=rpsQ)