Structure of PDB 8uvs Chain 1p

Receptor sequence

>8uvs1p (length=82) Species: 300852 (Thermus thermophilus HB8)

MVKIRLARFGSKHNPHYRIVVTDARRKRDGKYIEKIGYYDPRKTTPDWLK
VDVERARYWLSVGAQPTDTARRLLRQAGVFRQ

3D structure

• PDB: 8uvs Development of 2nd generation aminomethyl spectinomycins that overcome native efflux in Mycobacterium abscessus.
• Chain: 1p
• Resolution: 2.75 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	1p	M1 V2 K3 R5 L6 R8 G10 S11 K12 H13 H16 Y17 R18 R25 R26 K27 R28 K31 Y38 P41 R42 K43 W59 V62 G63 Q65 T67 D68 T69 R72 R75 F80 R81 Q82	M1 V2 K3 R5 L6 R8 G10 S11 K12 H13 H16 Y17 R18 R25 R26 K27 R28 K31 Y38 P41 R42 K43 W59 V62 G63 Q65 T67 D68 T69 R72 R75 F80 R81 Q82

External links

• PDB: RCSB:8uvs, PDBe:8uvs, PDBj:8uvs
• PDBsum: 8uvs
• PubMed: 38165935
• UniProt: Q5SJH3|RS16_THET8 Small ribosomal subunit protein bS16 (Gene Name=rpsP)