Structure of PDB 4z8c Chain 1o

Receptor sequence
>4z8c1o (length=88) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHH
SHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
3D structure
PDB4z8c The mechanism of inhibition of protein synthesis by the proline-rich peptide oncocin.
Chain1o
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 1o H53 L56 V60 G89 H52 L55 V59 G88
BS02 rna 1o P2 K8 F18 T22 G23 S24 Q28 L31 R35 H42 H46 K48 D49 H50 H51 S52 R54 G55 M58 M59 R64 R65 Y69 P1 K7 F17 T21 G22 S23 Q27 L30 R34 H41 H45 K47 D48 H49 H50 S51 R53 G54 M57 M58 R63 R64 Y68
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4z8c, PDBe:4z8c, PDBj:4z8c
PDBsum4z8c
PubMed25984972
UniProtQ5SJ76|RS15_THET8 Small ribosomal subunit protein uS15 (Gene Name=rpsO)

[Back to BioLiP]