Structure of PDB 8vtx Chain 1n

Receptor sequence

>8vtx1n (length=60) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

ARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKG
QLPGVRKASW

3D structure

PDB

8vtx Macrolones target bacterial ribosomes and DNA gyrase and can evade resistance mechanisms.

Chain

Resolution

2.4 Å

3D
structure

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	1n	A2 R3 K4 A5 L6 E8 K9 K15 F16 K17 V18 R19 Y21 R29 R31 S32 Y34 R35 R41 I42 R45 E46 K58 S60 W61	A1 R2 K3 A4 L5 E7 K8 K14 F15 K16 V17 R18 Y20 R28 R30 S31 Y33 R34 R40 I41 R44 E45 K57 S59 W60
BS02	ZN	1n	C24 C27 C40 C43	C23 C26 C39 C42

External links

PDB	RCSB:8vtx, PDBe:8vtx, PDBj:8vtx
PDBsum	8vtx
PubMed	39039256
UniProt	P0DOY6\|RS14Z_THET8 Small ribosomal subunit protein uS14 (Gene Name=rpsZ)