Structure of PDB 8cvj Chain 1n

Receptor sequence
>8cvj1n (length=60) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
ARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKG
QLPGVRKASW
3D structure
PDB8cvj Insights into the ribosome function from the structures of non-arrested ribosome-nascent chain complexes.
Chain1n
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna 1n A2 R3 K4 A5 E8 K9 F16 K17 V18 R19 Y21 R29 R31 S32 R35 R41 I42 R45 E46 K58 S60 W61 A1 R2 K3 A4 E7 K8 F15 K16 V17 R18 Y20 R28 R30 S31 R34 R40 I41 R44 E45 K57 S59 W60
BS02 ZN 1n C24 C27 C40 C43 C23 C26 C39 C42
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0019843 rRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8cvj, PDBe:8cvj, PDBj:8cvj
PDBsum8cvj
PubMed36316410
UniProtP0DOY6|RS14Z_THET8 Small ribosomal subunit protein uS14 (Gene Name=rpsZ)

[Back to BioLiP]