Structure of PDB 6n9e Chain 1k

Receptor sequence
>6n9e1k (length=114) Species: 274 (Thermus thermophilus) [Search protein sequence]
QVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQ
LAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDT
PVPHNGCRPKKKFR
3D structure
PDB6n9e Mechanistic insights into the slow peptide bond formation with D-amino acids in the ribosomal active site.
Chain1k
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 1k Y20 N26 N27 I29 T31 N38 P39 W42 S44 G46 G52 S53 K55 R85 H116 N117 G118 C119 R120 K122 K123 Y8 N14 N15 I17 T19 N26 P27 W30 S32 G34 G40 S41 K43 R73 H104 N105 G106 C107 R108 K110 K111
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6n9e, PDBe:6n9e, PDBj:6n9e
PDBsum6n9e
PubMed30520988
UniProtP80376|RS11_THET8 Small ribosomal subunit protein uS11 (Gene Name=rpsK)

[Back to BioLiP]