Structure of PDB 8ev6 Chain 1j

Receptor sequence
>8ev61j (length=97) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
IRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGP
FKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
3D structure
PDB8ev6 Molecular basis of the pleiotropic effects by the antibiotic amikacin on the ribosome.
Chain1j
Resolution2.946 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna 1j R5 K7 R9 H13 S35 G36 P37 I38 P39 L40 P41 T42 R43 V44 R45 T48 R51 G52 P53 F54 K55 H56 K57 R60 H62 H68 R70 R2 K4 R6 H10 S32 G33 P34 I35 P36 L37 P38 T39 R40 V41 R42 T45 R48 G49 P50 F51 K52 H53 K54 R57 H59 H65 R67
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8ev6, PDBe:8ev6, PDBj:8ev6
PDBsum8ev6
PubMed37537169
UniProtQ5SHN7|RS10_THET8 Small ribosomal subunit protein uS10 (Gene Name=rpsJ)

[Back to BioLiP]