Structure of PDB 8ud8 Chain 1h

Receptor sequence

>8ud81h (length=137) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

LTDPIADMLTRIRNATRVYKESTDVPASRFKEEILRILAREGFIKGYERV
DVDGKPYLRVYLKYGPRRQGPDPRPEQVIHHIRRISKPGRRVYVGVKEIP
RVRRGLGIAILSTSKGVLTDREARKLGVGGELICEVW

3D structure

PDB

8ud8 An antibiotic preorganized for ribosomal binding overcomes antimicrobial resistance

Chain

Resolution

2.6 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	1h	L2 T3 P5 D8 T11 R12 R14 N15 V19 K21 S29 R30 F31 K56 R75 K88 P89 G90 R91 R92 Y94 G96 V97 R105 S113 T114 S115 G128 V129 G130 E132	L1 T2 P4 D7 T10 R11 R13 N14 V18 K20 S28 R29 F30 K55 R74 K87 P88 G89 R90 R91 Y93 G95 V96 R104 S112 T113 S114 G127 V128 G129 E131

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8ud8, PDBe:8ud8, PDBj:8ud8
PDBsum	8ud8
PubMed	38359125
UniProt	P0DOY9\|RS8_THET8 Small ribosomal subunit protein uS8 (Gene Name=rpsH)