Structure of PDB 6fkr Chain 1h

Receptor sequence
>6fkr1h (length=137) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
LTDPIADMLTRIRNATRVYKESTDVPASRFKEEILRILAREGFIKGYERV
DVDGKPYLRVYLKYGPRRQGPDPRPEQVIHHIRRISKPGRRVYVGVKEIP
RVRRGLGIAILSTSKGVLTDREARKLGVGGELICEVW
3D structure
PDB6fkr The Dolphin Proline-Rich Antimicrobial Peptide Tur1A Inhibits Protein Synthesis by Targeting the Bacterial Ribosome.
Chain1h
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 1h L2 T3 D8 T11 R12 R14 N15 S29 F31 K56 K88 P89 G90 R92 Y94 G96 V97 K98 R102 R105 S113 T114 S115 G128 V129 G130 E132 L1 T2 D7 T10 R11 R13 N14 S28 F30 K55 K87 P88 G89 R91 Y93 G95 V96 K97 R101 R104 S112 T113 S114 G127 V128 G129 E131
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6fkr, PDBe:6fkr, PDBj:6fkr
PDBsum6fkr
PubMed29526712
UniProtP0DOY9|RS8_THET8 Small ribosomal subunit protein uS8 (Gene Name=rpsH)

[Back to BioLiP]