Structure of PDB 8uvs Chain 1e

Receptor sequence

>8uvs1e (length=148) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLA
VQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGA
VPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLR

3D structure

PDB

8uvs Development of 2nd generation aminomethyl spectinomycins that overcome native efflux in Mycobacterium abscessus.

Chain

Resolution

2.75 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	1e	R14 T16 A17 R18 M19 Q20 R24 R25 K47 P49 A94 A95 T98 A102 L119 T120 K121 E122 L123 S125 R126 N127 N130 Y133	R10 T12 A13 R14 M15 Q16 R20 R21 K43 P45 A90 A91 T94 A98 L115 T116 K117 E118 L119 S121 R122 N123 N126 Y129
BS02	Y7K	1e	A21 R25	A17 R21
BS03	MG	1e	G85 A86 S87 S125	G81 A82 S83 S121

External links

PDB	RCSB:8uvs, PDBe:8uvs, PDBj:8uvs
PDBsum	8uvs
PubMed	38165935
UniProt	Q5SHQ5\|RS5_THET8 Small ribosomal subunit protein uS5 (Gene Name=rpsE)

[Back to BioLiP]