Structure of PDB 6o97 Chain 1e

Receptor sequence

>6o971e (length=148) Species: 300852 (Thermus thermophilus HB8)

DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLA
VQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGA
VPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLR

3D structure

• PDB: 6o97 Design, Multigram Synthesis, and in Vitro and in Vivo Evaluation of Propylamycin: A Semisynthetic 4,5-Deoxystreptamine Class Aminoglycoside for the Treatment of Drug-Resistant Enterobacteriaceae and Other Gram-Negative Pathogens.
• Chain: 1e
• Resolution: 2.75 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	1e	R14 T16 A17 R18 M19 Q20 A21 G22 R24 R25 R27 K47 K57 Y61 F84 A86 K92 A94 A95 T98 I101 A102 L119 T120 K121 E122 S125 R126 N127 N130 Y133	R10 T12 A13 R14 M15 Q16 A17 G18 R20 R21 R23 K43 K53 Y57 F80 A82 K88 A90 A91 T94 I97 A98 L115 T116 K117 E118 S121 R122 N123 N126 Y129
BS02	MG	1e	G85 N130	G81 N126
BS03	MG	1e	E68 D147	E64 D143

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6o97, PDBe:6o97, PDBj:6o97
• PDBsum: 6o97
• PubMed: 30793894
• UniProt: Q5SHQ5|RS5_THET8 Small ribosomal subunit protein uS5 (Gene Name=rpsE)