Structure of PDB 8vty Chain 1d

Receptor sequence

>8vty1d (length=208) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

GRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPGQHGQKRARRP
SDYAVRLREKQKLRRIYGISERQFRNLFEEASKKKGVTGSVFLGLLESRL
DNVVYRLGFAVSRRQARQLVRHGHITVNGRRVDLPSYRVRPGDEIAVAEK
SRNLELIRQNLEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVNEQ
LVIEFYSR

3D structure

PDB

8vty Macrolones target bacterial ribosomes and DNA gyrase and can evade resistance mechanisms.

Chain

Resolution

2.6 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	1d	G2 R3 I5 P7 V8 C9 R10 R13 R14 K22 E24 R25 K30 R35 R36 Y38 P40 G41 Q42 H43 Q45 K46 S52 Y54 A55 L58 R59 Q62 R66 E72 R73 Q74 K85 V112 S113 R115 Q116 R118 Q119 R122 H123 H125 R132 V133 D134 L135 S137 Y138 R141 L155 E205 S208 R209	G1 R2 I4 P6 V7 C8 R9 R12 R13 K21 E23 R24 K29 R34 R35 Y37 P39 G40 Q41 H42 Q44 K45 S51 Y53 A54 L57 R58 Q61 R65 E71 R72 Q73 K84 V111 S112 R114 Q115 R117 Q118 R121 H122 H124 R131 V132 D133 L134 S136 Y137 R140 L154 E204 S207 R208
BS02	SF4	1d	C9 C12 L19 K22 C26 C31 A32 M33	C8 C11 L18 K21 C25 C30 A31 M32

External links

PDB	RCSB:8vty, PDBe:8vty, PDBj:8vty
PDBsum	8vty
PubMed	39039256
UniProt	P80373\|RS4_THET8 Small ribosomal subunit protein uS4 (Gene Name=rpsD)

[Back to BioLiP]