Structure of PDB 8uvs Chain 1d

Receptor sequence

>8uvs1d (length=208) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

GRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPGQHGQKRARRP
SDYAVRLREKQKLRRIYGISERQFRNLFEEASKKKGVTGSVFLGLLESRL
DNVVYRLGFAVSRRQARQLVRHGHITVNGRRVDLPSYRVRPGDEIAVAEK
SRNLELIRQNLEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVNEQ
LVIEFYSR

3D structure

PDB

8uvs Development of 2nd generation aminomethyl spectinomycins that overcome native efflux in Mycobacterium abscessus.

Chain

Resolution

2.75 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	1d	G2 R3 I5 P7 V8 C9 R10 R13 R14 K22 E24 R25 K30 R35 R36 Y38 P40 G41 Q42 H43 R49 S52 A55 L58 R59 K61 Q62 R65 R66 E72 R73 Q74 N77 S113 R115 Q116 R118 Q119 R122 H123 H125 V133 D134 L135 S137 R141 L155 S208 R209	G1 R2 I4 P6 V7 C8 R9 R12 R13 K21 E23 R24 K29 R34 R35 Y37 P39 G40 Q41 H42 R48 S51 A54 L57 R58 K60 Q61 R64 R65 E71 R72 Q73 N76 S112 R114 Q115 R117 Q118 R121 H122 H124 V132 D133 L134 S136 R140 L154 S207 R208
BS02	SF4	1d	C9 C12 K18 L19 C26 C31 M33	C8 C11 K17 L18 C25 C30 M32

External links

PDB	RCSB:8uvs, PDBe:8uvs, PDBj:8uvs
PDBsum	8uvs
PubMed	38165935
UniProt	P80373\|RS4_THET8 Small ribosomal subunit protein uS4 (Gene Name=rpsD)

[Back to BioLiP]