Structure of PDB 4z8c Chain 1d

Receptor sequence

>4z8c1d (length=208) Species: 300852 (Thermus thermophilus HB8)

GRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPGQHGQKRARRP
SDYAVRLREKQKLRRIYGISERQFRNLFEEASKKKGVTGSVFLGLLESRL
DNVVYRLGFAVSRRQARQLVRHGHITVNGRRVDLPSYRVRPGDEIAVAEK
SRNLELIRQNLEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVNEQ
LVIEFYSR

3D structure

• PDB: 4z8c The mechanism of inhibition of protein synthesis by the proline-rich peptide oncocin.
• Chain: 1d
• Resolution: 2.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	1d	G2 R3 I5 P7 V8 C9 R10 R13 R14 K22 E24 R25 R35 R36 Y38 P40 G41 Q42 H43 S52 Y54 A55 R59 Q62 E72 R73 Q74 V112 S113 R115 Q116 R118 Q119 R122 H123 H125 R132 D134 S137 R141 L155 S208 R209	G1 R2 I4 P6 V7 C8 R9 R12 R13 K21 E23 R24 R34 R35 Y37 P39 G40 Q41 H42 S51 Y53 A54 R58 Q61 E71 R72 Q73 V111 S112 R114 Q115 R117 Q118 R121 H122 H124 R131 D133 S136 R140 L154 S207 R208
BS02	SF4	1d	C9 C12 Y20 L21 K22 C26 C31	C8 C11 Y19 L20 K21 C25 C30
BS03	MG	1d	G87 T89	G86 T88

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006412 translation
• GO:0042274 ribosomal small subunit biogenesis

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4z8c, PDBe:4z8c, PDBj:4z8c
• PDBsum: 4z8c
• PubMed: 25984972
• UniProt: P80373|RS4_THET8 Small ribosomal subunit protein uS4 (Gene Name=rpsD)