Structure of PDB 6ucq Chain 1b

Receptor sequence

>6ucq1b (length=231) Species: 300852 (Thermus thermophilus HB8)

VKELLEAGVHFGHERKRWNPKFARYIYAERNGIHIIDLQKTMEELERTFR
FIEDLAMRGGTILFVGTKKQAQDIVRMEAERAGMPYVNQRWLGGMLTNFK
TISQRVHRLEELEALFASPEIEERPKKEQVRLKHELERLQKYLSGFRLLK
RLPDAIFVVDPTKEAIAVREARKLFIPVIALADTDSDPDLVDYIIPGNDD
AIRSIQLILSRAVDLIIQARGGVVEPSPSYA

3D structure

• PDB: 6ucq Structural basis for ribosome recycling by RRF and tRNA.
• Chain: 1b
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	1b	P26 R96 L98 G99 G100 T103 N104 I108 R111 K133 R144 I172 E176 K179	P20 R90 L92 G93 G94 T97 N98 I102 R105 K127 R138 I166 E170 K173
BS02	MG	1b	K74 D166 K169	K68 D160 K163
BS03	MG	1b	D166 D189 D191 D205	D160 D183 D185 D199
BS04	MG	1b	D166 A188 D189 D205	D160 A182 D183 D199
BS05	MG	1b	E84 P234	E78 P228
BS06	MG	1b	A120 L121 S124	A114 L115 S118
BS07	MG	1b	E170 I172 A173	E164 I166 A167
BS08	MG	1b	P167 E170 A171 V174	P161 E164 A165 V168
BS09	MG	1b	G14 V15	G8 V9

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6ucq, PDBe:6ucq, PDBj:6ucq
• PDBsum: 6ucq
• PubMed: 31873307
• UniProt: P80371|RS2_THET8 Small ribosomal subunit protein uS2 (Gene Name=rpsB)