Structure of PDB 6xhw Chain 1Z

Receptor sequence
>6xhw1Z (length=154) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
MEYRLKAYYREGEKPSALRRAGKLPGVMYNRHLNRKVYVDLVEFDKVFRQ
ASIHHVIVLELPDGQSLPTLVRQVNLDKRRRRPEHVDFFVLSDEPVEMYV
PLRFVEIHRDILVKVSPRNIPEFIEVDVIGDSLHASDLKLPPGVELAVSP
EETI
3D structure
PDB6xhw Structure of Erm-modified 70S ribosome reveals the mechanism of macrolide resistance.
Chain1Z
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 1Z H151 E169 T170 H134 E152 T153
BS02 rna 1Z R10 K14 P15 R19 V27 Y29 N30 R31 N34 K36 R72 Q73 N75 R79 E84 H85 D87 F89 R10 K14 P15 R19 V27 Y29 N30 R31 N34 K36 R72 Q73 N75 R79 E84 H85 D87 F89
BS03 MG 1Z Y29 D87 Y29 D87
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6xhw, PDBe:6xhw, PDBj:6xhw
PDBsum6xhw
PubMed33462493
UniProtQ5SHZ1|RL25_THET8 Large ribosomal subunit protein bL25 (Gene Name=rplY)

[Back to BioLiP]