Structure of PDB 4z8c Chain 1Y

Receptor sequence

>4z8c1Y (length=107) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

MRVKMHVKKGDTVLVASGKYKGRVGKVKEVLPKKYAVIVEGVNIVKKAVR
VSPKYPQGGFIEKEAPLHASKVRPICPACGKPTRVRKKFLENGKKIRVCA
KCGGALD

3D structure

PDB

4z8c The mechanism of inhibition of protein synthesis by the proline-rich peptide oncocin.

Chain

Resolution

2.9 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	1Y	M1 R2 K4 K8 K9 S17 G18 K19 K21 V30 P32 Y35 K46 K47 A48 V49 R50 V51 G58 G59 F60 H68 S70 K71 R73 R84 R86 K87 K95	M1 R2 K4 K8 K9 S17 G18 K19 K21 V30 P32 Y35 K46 K47 A48 V49 R50 V51 G58 G59 F60 H68 S70 K71 R73 R84 R86 K87 K95
BS02	ZN	1Y	C76 C79 C99 C102	C76 C79 C99 C102

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:4z8c, PDBe:4z8c, PDBj:4z8c
PDBsum	4z8c
PubMed	25984972
UniProt	Q5SHP9\|RL24_THET8 Large ribosomal subunit protein uL24 (Gene Name=rplX)