Structure of PDB 6o97 Chain 1X |
>6o971X (length=95) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] |
MKTAYDVILAPVLSEKAYAGFAEGKYTFWVHPKATKTEIKNAVETAFKVK VVKVNTLHVRGKKKRLGRYLGKRPDRKKAIVQVAPGQKIEALEGL |
|
PDB | 6o97 Design, Multigram Synthesis, and in Vitro and in Vivo Evaluation of Propylamycin: A Semisynthetic 4,5-Deoxystreptamine Class Aminoglycoside for the Treatment of Drug-Resistant Enterobacteriaceae and Other Gram-Negative Pathogens. |
Chain | 1X |
Resolution | 2.75 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
|
|
|