Structure of PDB 9b00 Chain 1W

Receptor sequence

>9b001W (length=112) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

MEAKAIARYVRISPRKVRLVVDLIRGKSLEEARNILRYTNKRGAYFVAKV
LESAAANAVNNHDMLEDRLYVKAAYVDEGPALKRVLPRARGRADIIKKRT
SHITVILGEKHG

3D structure

PDB

9b00 Berberine analog of chloramphenicol exhibits a distinct mode of action and unveils ribosome plasticity.

Chain

Resolution

2.8 Å

3D
structure

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	1W	K4 A5 I6 A7 R8 Y9 R11 S13 R15 K16 R18 R25 N40 K41 R42 Y45 K49 S53 A56 N57 N60 N61 H62 D77 E78 P80 K83 R84 P87 R88 A89 R90 G91 R92 A93 D94 I96 K97 K98 H102	K4 A5 I6 A7 R8 Y9 R11 S13 R15 K16 R18 R25 N40 K41 R42 Y45 K49 S53 A56 N57 N60 N61 H62 D77 E78 P80 K83 R84 P87 R88 A89 R90 G91 R92 A93 D94 I96 K97 K98 H102
BS02	MG	1W	Y75 D77	Y75 D77
BS03	MG	1W	E78 A81 R99	E78 A81 R99
BS04	MG	1W	I95 K97	I95 K97
BS05	MG	1W	Y75 D77 H102 T104	Y75 D77 H102 T104

External links

PDB	RCSB:9b00, PDBe:9b00, PDBj:9b00
PDBsum	9b00
PubMed	39019034
UniProt	Q5SHP3\|RL22_THET8 Large ribosomal subunit protein uL22 (Gene Name=rplV)