Structure of PDB 8vtw Chain 1W

Receptor sequence

>8vtw1W (length=112) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

MEAKAIARYVRISPRKVRLVVDLIRGKSLEEARNILRYTNKRGAYFVAKV
LESAAANAVNNHDMLEDRLYVKAAYVDEGPALKRVLPRARGRADIIKKRT
SHITVILGEKHG

3D structure

PDB

8vtw Macrolones target bacterial ribosomes and DNA gyrase and can evade resistance mechanisms.

Chain

Resolution

2.35 Å

3D
structure

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	1W	K4 A5 I6 A7 R8 Y9 R11 S13 R15 K16 R18 R25 N40 K41 R42 Y45 K49 S53 A56 N57 N60 N61 H62 Y75 D77 E78 P80 K83 R84 P87 R88 A89 R90 G91 R92 A93 D94 K97 K98 R99 H102	K4 A5 I6 A7 R8 Y9 R11 S13 R15 K16 R18 R25 N40 K41 R42 Y45 K49 S53 A56 N57 N60 N61 H62 Y75 D77 E78 P80 K83 R84 P87 R88 A89 R90 G91 R92 A93 D94 K97 K98 R99 H102
BS02	MG	1W	I95 I96 K97	I95 I96 K97

External links

PDB	RCSB:8vtw, PDBe:8vtw, PDBj:8vtw
PDBsum	8vtw
PubMed	39039256
UniProt	Q5SHP3\|RL22_THET8 Large ribosomal subunit protein uL22 (Gene Name=rplV)