Structure of PDB 8t8b Chain 1W

Receptor sequence

>8t8b1W (length=112) Species: 300852 (Thermus thermophilus HB8)

MEAKAIARYVRISPRKVRLVVDLIRGKSLEEARNILRYTNKRGAYFVAKV
LESAAANAVNNHDMLEDRLYVKAAYVDEGPALKRVLPRARGRADIIKKRT
SHITVILGEKHG

3D structure

• PDB: 8t8b Practical Synthesis of N -Formylmethionylated Peptidyl-tRNA Mimics.
• Chain: 1W
• Resolution: 2.65 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	1W	K4 A5 I6 A7 R8 Y9 R11 S13 R15 K16 R18 R25 N40 K41 R42 Y45 K49 S53 A56 N57 N60 N61 H62 Y75 D77 E78 G79 P80 K83 R84 P87 R88 A89 R90 G91 R92 A93 D94 I96 K97 K98 R99 H102	K4 A5 I6 A7 R8 Y9 R11 S13 R15 K16 R18 R25 N40 K41 R42 Y45 K49 S53 A56 N57 N60 N61 H62 Y75 D77 E78 G79 P80 K83 R84 P87 R88 A89 R90 G91 R92 A93 D94 I96 K97 K98 R99 H102
BS02	MG	1W	I95 K97	I95 K97
BS03	MG	1W	T39 N40	T39 N40

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8t8b, PDBe:8t8b, PDBj:8t8b
• PDBsum: 8t8b
• PubMed: 37433044
• UniProt: Q5SHP3|RL22_THET8 Large ribosomal subunit protein uL22 (Gene Name=rplV)